PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011083616.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family TALE
Protein Properties Length: 657aa    MW: 73326.6 Da    PI: 5.3949
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011083616.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.23.1e-094274641954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +e+  LA+++gLt +qV +WF N R +
  XP_011083616.1 427 FEHflHPYPKDSEKIVLARQTGLTRSQVANWFINARVR 464
                     664459******************************88 PP

2BELL124.44.5e-40293364172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     er+elq+k +kLls+l+eVd+rYkqy++q+q+v+ssF++vag g+a pYt+lAl++iSr+FrcL+d i++qi
  XP_011083616.1 293 ERHELQNKLTKLLSMLDEVDRRYKQYCHQMQVVVSSFDMVAGRGAAVPYTALALRTISRQFRCLRDGIKKQI 364
                     79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005746.6E-56220362IPR006563POX domain
PfamPF075262.9E-46228360IPR006563POX domain
PROSITE profilePS5007112.147405468IPR001356Homeobox domain
SMARTSM003891.0E-9408472IPR001356Homeobox domain
CDDcd000866.02E-12408469No hitNo description
SuperFamilySSF466892.18E-17409475IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.5E-28411474IPR009057Homeodomain-like
PfamPF059208.3E-17425464IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 657 aa     Download sequence    Send to blast
MASFYPSEGD MLPTSYMLNQ KLPSYPSSEI ANNKVYVSQP SATLSYANLL SGSSLSTHEL  60
VEAESVGSRD EMVFIPPNSV PTGMQQIDRQ LNFTPRYSDG NTVIADTHIF SKESVNVNSS  120
EPIPQYHGLS LSLGSQEPPL VQLHSDLSQY TSSSLCSLLS SDMQSELQLS QNNNLKSVQY  180
LSFDLAGKTQ ETVKYGAINN FGNLISSKET SFIPSPHQAP EFTGTFCNSK YLKAAQDLLI  240
ELVSVHRAPK LLEKFRNMNG QDSSTGTDLK RDGFSAELQE SSNNAPRDLS PSERHELQNK  300
LTKLLSMLDE VDRRYKQYCH QMQVVVSSFD MVAGRGAAVP YTALALRTIS RQFRCLRDGI  360
KKQIQATQKS LGEQDVNSQG VLSRLRYVDQ QLRQQKALQQ FGVMRQPWRP QRGLPETAVS  420
ILRAWLFEHF LHPYPKDSEK IVLARQTGLT RSQVANWFIN ARVRLWKPMI EEMYKEEFGD  480
AETEPRSSPE HATTAQETCA FDDREEEFQG NLFTAAANSN QPMQSNESRP DFMSSGHLAY  540
ENGPYQGNEV NFRLTHMPNE QIVSLAGNSI FSDNNASTNK TGDENVIDGN IGNQVSLALG  600
LQHSEKDSKS TADGVEAKGN DATSSSMVLD KMDYYYVDPV NNQNRFGNSH LLSDFVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A9e-17414472563Homeobox protein Meis2
3k2a_B9e-17414472563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011083613.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_011083614.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_011083616.10.0PREDICTED: BEL1-like homeodomain protein 7
TrEMBLA0A068UFX50.0A0A068UFX5_COFCA; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34610.21e-109BEL1-like homeodomain 6